DPCstruct | MC60295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9EMH6 | 1-68 | MLTYSEDLEYFVPYLQQLDMESNGKSINKQGRRVDYDTGPIIWGGPGNQAQHSYYQLLCQGTLKIATV |
| A0A7J6MH11 | 342-402 | LPYCQALVRFVAHIQQLDMESNGKRVTLSGHAVDYSTGMVHFGEPGTNGQHSFYQELHQGT |
| A0A0C2MI94 | 17-97 | None |
| A0A376FFA7 | 31-109 | None |
| S4MSR7 | 351-411 | None |
| A0A4S8IU70 | 342-401 | None |
| D7G558 | 111-176 | None |
| A0A6M1HZN0 | 68-132 | None |
| A0A4T0QAF2 | 916-976 | None |
| A0A812LEP7 | 858-927 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.