DPCstruct | MC60293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 196 ± 37 aa |
| Standard deviation of domain lengths | 37.01 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0B2S1 | 49-206 | DKLSSGILSFNLDLISELNNEKVKEYMMKKNGCFIKLMALTVYHDDLAIQEKGRSLYNSYLEIEEIKDFAKEENLWNNKTVDWSDKK… |
| A0A379WS42 | 296-477 | RFFAHQCQTYNDVPLPAPDTYYQQRILPVLLDSFDRNSAAMTTHSGFFNQVILHCMTGVDCTDGTRQKAAALYEQYLAHPAVSPHIH… |
| A0A826QP61 | 1-183 | None |
| A0A447P8W9 | 50-228 | None |
| A0A6S6RPM8 | 52-220 | None |
| A0A5F0A5E5 | 250-431 | None |
| D2T7E2 | 63-237 | None |
| E0WT68 | 263-439 | None |
| A0A6I7D912 | 146-355 | None |
| A0A8B5MSS8 | 40-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.