DPCstruct | MC60292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 14.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10765 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I7CZP6 | 3-99 | SYNKYTDLQINELVATRLKKKCLLTEESVLAYMDSGYRTFDPCNNPTDAMPIIIENEISMIKSSGGWMCCHGSVGQVERESLYRGAM… |
| A0A6P2FHR7 | 1-105 | MKTTELTGLYLSYWVAKAEGREPERFDREGRGWIRCKDDFMPFDAEQWHVAGPIIGRLGIEFEDNGRTAVIDYDRDGVWVGRGDSHT… |
| R9VF92 | 1-123 | None |
| A0A522FGD6 | 1-129 | None |
| A0A7W4VJS9 | 1-112 | None |
| A0A4Q3WHB0 | 50-157 | None |
| A0A2S5L9V6 | 78-200 | None |
| A0A1G7ZIC2 | 1-109 | None |
| A0A7W4N0W2 | 13-129 | None |
| A0A250LL12 | 195-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.