DPCstruct | MC6029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 397 ± 38 aa |
| Standard deviation of domain lengths | 37.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7YI91 | 210-603 | QLPVQNNSFLELHSYVHEETHAIFDLANRPGSVIDLLPYYIDKENIKIIAKHNYPRPIINTLSRILDNKRYSGYIIEGITGSTNKHI… |
| A0A0L1JSP4 | 12-387 | LMSLCADHAQNARVFFSHDAGSDWVIDDDRLIHRQTQFFSIAGYAAPDGRHVLLLEQPETALVMLLLTRDPDGTRSFVLITRNEPGL… |
| F4REU8 | 174-616 | None |
| A0A509DVH0 | 337-768 | None |
| A0A411PXD5 | 306-741 | None |
| A0A4S2VDP5 | 178-622 | None |
| A0A4R4UBZ3 | 2-369 | None |
| A0A4Q3Y619 | 92-517 | None |
| A0A2X5C9S6 | 1-435 | None |
| A0A239ME51 | 35-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.