DPCstruct | MC60289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 131 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M2B6D2 | 1-168 | MKKKLFLVAGALVLTVSAVGGATYAGMSKEKKVQLLEQRLVEFKANVDNDIAESFDVNLDNLEKLDHKEILNDENQIAIAKKYMEVS… |
| A0A7V9Z3L1 | 34-148 | EQKMEKFKNEVLMDIQKTFNLDLNAYQKYEYEQLRYQAEQGKFMKLAKINEDIVINELNKEIKPPYKNVIYPMTFIKGDEAFILYKK… |
| A0A553KLE7 | 71-199 | None |
| A0A124IKM4 | 40-169 | None |
| A0A101VTE2 | 1-154 | None |
| A0A853TG44 | 41-150 | None |
| A0A140L7D4 | 1-127 | None |
| A0A3D9R4H5 | 354-477 | None |
| A0A1T4XL77 | 91-212 | None |
| A0A6M0QBH9 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.