DPCstruct | MC60288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 143 ± 38 aa |
| Standard deviation of domain lengths | 38.44 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 52.50 |
| Assigned Pfam label(s) | PF12561- CL0126- PF20944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1UPQ1 | 1-126 | MNITSRLKTSGTGYIQSLDSVRALAAIFVLLLHGSYGYCYSPDGDAVKKSDSYLEVKTASGNLRYRLAPSRLRSGVMNKFHINIPAS… |
| A0A7V8I706 | 203-454 | DVLVPTTASSYAKCASSHQLDAQGRCYKQDPMQGGAGDQSSGYKFATFSDYNTGRMQAWIASRVLADPASSTGYSKWDSAAQARAPY… |
| A0A0W0PED7 | 859-972 | None |
| X0RFZ7 | 3-136 | None |
| A0A0N0X8Y2 | 2-110 | None |
| A0A376SCB6 | 449-564 | None |
| A0A2T3JC41 | 1123-1244 | None |
| A0A1E7F879 | 745-938 | None |
| A0A4Q0YTS3 | 253-380 | None |
| A0A7S3TZT0 | 3-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.