DPCstruct | MC60277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8ZAL7 | 6-88 | VKKHQRGKPLTRVEKQVILNVFSKLMDYNPEVAVYDIVKLTAEFTGVSHSSVMNIRKEHRETGVISTPKLKRKRPKTVLGKVD |
| A0A2P8XW81 | 1-101 | MANNSESGCSAVMSPVKNHVRGKGLTSGEKMQVLNLYKTVSKDNPEICVRDLVDKVAKSIGIGVSSVYRIMKEYKSAGEFKSPVKNK… |
| A0A7I0ZXI6 | 1-110 | None |
| A0A0L7L6Y3 | 3-97 | None |
| A0A6J2K7Q9 | 38-148 | None |
| A0A2P8Z207 | 5-108 | None |
| A0A3S2M598 | 1-111 | None |
| A0A6J1N080 | 530-636 | None |
| A0A437BXJ1 | 1-107 | None |
| A0A6G0TBZ7 | 383-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.