DPCstruct | MC60276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 195 ± 47 aa |
| Standard deviation of domain lengths | 46.95 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 68.07 |
| Assigned Pfam label(s) | CL0023- CL0329- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5D5H0 | 3-120 | KKINETKLSQEAREKAITDLKRYKKMNPISPEATVISSYLHWLLELPWGKYKDAKINLNAAKKILDENHYGIEKVKDRIIEFLAVLK… |
| A0A4Y2FV62 | 597-805 | LPDVCAAIVRASHTERLQILDAVDLAERFKKTLPLLVRQIEGLQLLQKARKEDIGPLDFTKIPFPRGKFFNDIDKEDEIAALEKKVR… |
| A0A3L7HZM2 | 301-490 | None |
| A0A540LZ90 | 220-411 | None |
| A0A2V7SVH3 | 183-371 | None |
| A0A0N1PKJ3 | 92-290 | None |
| B6ACI0 | 350-607 | None |
| A0A2G3BEF1 | 48-269 | None |
| A0A6J3BWV6 | 6-143 | None |
| A0A0N4VV57 | 85-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.