DPCstruct | MC60274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 387 |
|---|---|
| Mean domain length (aa) | 204 ± 53 aa |
| Standard deviation of domain lengths | 52.82 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 72.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.61 |
| Pfam Score | 77.21 |
| Assigned Pfam label(s) | CL0192- CL0056- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2CVG5 | 2-172 | MTEICNFCQALDWRNELNSSNKYTKCCHDGKVRLPNLAETPDLLKELLTNNSLKARNYQQHIREYNAALAFASMGAEGKAPPGNGPY… |
| F4SDA5 | 4-212 | DLGPLDDPCQRCGALHWIAERPSSAKVTGPYEYNMCCSGGKIKPPVDFLGDHVVPEFVRTLMTSNDEGSAKYRDNIQSYNNALSFTS… |
| A0A834SRC2 | 1-186 | None |
| A0A5E4ELY4 | 174-322 | None |
| A0A1R3KWW2 | 114-308 | None |
| A0A4Y2CMF4 | 51-223 | None |
| A0A445D5U8 | 33-213 | None |
| A0A6P5G405 | 254-549 | None |
| A0A834SNZ1 | 381-618 | None |
| A0A1R3L0F8 | 15-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.