DPCstruct | MC60273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 186 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4VAN2 | 180-376 | SPPESNPPLHLYFHLDLGTIFTHDDRHAFMAEMDWPFKLTVFGSVYTLVSRGFWAKDHYWGKVLRHVNGLMGVWMHDNQHNAGHARL… |
| A0A0L0URB8 | 19-166 | LFSRGFWTNNHYWCKVVRSGEGGATGVWLHDEARNEGIARLVNKDTSSIGGCQPGTSWVFYSCRWTPSEEQYVRDSISKITHDHPDA… |
| A0A2S4V529 | 180-376 | None |
| A0A2S4V436 | 2-174 | None |
| A0A2S4UKR6 | 559-746 | None |
| A0A2S4UK20 | 320-524 | None |
| F4R613 | 1-226 | None |
| F4R2Y9 | 1-208 | None |
| A0A180G3Y4 | 268-451 | None |
| E3JTV8 | 30-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.