DPCstruct | MC60272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 152 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4SBE3 | 6-155 | NIKNRPTPADLAWFRSLDARSKSEVFPFPMSERHHPCVRAGIEQCYTCNKFGHSRMNGKPCTSRVKAGGALFKDWRRTVNGLSYSKD… |
| F4RW10 | 3-135 | IPDCRQSEINPIALPDTAVAEVKQGQDMCYWCGGFGHMQNVCPSRRAKLARTARPYKDWRLLAGVRKLYSINVLWPTTPVPVPVPVP… |
| F4SDT1 | 1-138 | None |
| F4SDS0 | 24-166 | None |
| F4S8M9 | 2-155 | None |
| F4S4C8 | 2-155 | None |
| F4S0Q5 | 1-190 | None |
| F4RWP5 | 1-126 | None |
| F4RL56 | 147-298 | None |
| F4RBM6 | 19-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.