DPCstruct | MC6027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 82.80 |
| Assigned Pfam label(s) | CL0261- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1BSF0 | 81-184 | AFQGLRPLFGLLEENLFWLAGRAIEIMNWDRTHQYCGRCGTPTQTRPNERAKVCPWCGLINFPRISPAIIVAVLKDKQILLTRAHRF… |
| A0A4W4GJW6 | 2-108 | EQLCNGVFTDLRKAFFLLTEPEASLAAKGQALLRWHQTHGFCSATGQPTVRNQSGSQRVCPNSGVTYYPQMAPVVIVLVSDGSRCLL… |
| A0A3S4X001 | 55-146 | None |
| A0A673BCQ1 | 115-229 | None |
| A0A2X2CMQ5 | 1-82 | None |
| A0A6P5FVX6 | 138-252 | None |
| A0A812NC56 | 79-189 | None |
| D9UTS0 | 95-228 | None |
| A0A6P6QHF9 | 1-109 | None |
| M1VDM8 | 269-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.