DPCstruct | MC60266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 238 ± 32 aa |
| Standard deviation of domain lengths | 32.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4S2P2 | 1-230 | MDTPTVPVDLRQHKYWDKVQTVPDHIKYLLKPDLDYSAKRTKKEDLRDMMKHFAIDRSKYPTSHKKDKLLETYKDLLLPDLEPFIPK… |
| F4RZM4 | 1-272 | MAKSKAKSPKASSPDMKMNSPTSTAPGATTSTLDAKSIPPTVNKSEPAPSYASPNAEVDPEVAAKISTLPETLKVFLERDFETKSKS… |
| F4RNI9 | 3-243 | None |
| A0A2S4UE00 | 115-400 | None |
| F4SAX7 | 14-231 | None |
| F4SAR2 | 40-241 | None |
| F4RYL9 | 1-231 | None |
| F4RJZ3 | 1-285 | None |
| F4RYB3 | 140-396 | None |
| F4RC84 | 1-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.