DPCstruct | MC60261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 200 ± 37 aa |
| Standard deviation of domain lengths | 37.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.34 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF18870- CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M2GX72 | 6-200 | LDEKAVCGTCIGNKFLSQKISASETTDVACDYCGRNAPTLGLDEIAQIFDHEFQDNYQVADNILREDHGYPSLGDELQEIIQQEVEP… |
| A0A1N6UWV6 | 2-164 | LVCKDCFSDNELKRFIISSGHNNGCGFCKKKDIETINLEELFDFFKELFDKFQIKTDGERLISKIQGNWNLFSDIAIGNRIMNYVIG… |
| A0A2N7ECF4 | 1-203 | None |
| A0A6L7S1X6 | 227-481 | None |
| B0T8L0 | 26-269 | None |
| A0A370WXV3 | 12-263 | None |
| A0A6I6U701 | 15-267 | None |
| A0A1G8C498 | 10-178 | None |
| A0A4R0QKP9 | 1-178 | None |
| A3TZZ4 | 17-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.