DPCstruct | MC6026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 64.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3B862 | 37-105 | LTCEPSGERKEKKYTNFTLCEVCNIQLNSAAQADIHYNGKSHQRRIKQLNNGRPASSNDADAIIGSSGC |
| A0A091E4B0 | 1-74 | MSDDFEEKPEREKKHTNFTLCNVCNIQLNSAAQAEIHYNGKSHQKRLKQLSNGMLKNDNGKLLYNYGLKFTLST |
| A0A3L8S068 | 26-100 | None |
| L9KHA8 | 95-163 | None |
| A0A672G610 | 6-84 | None |
| A0A672UGZ9 | 24-98 | None |
| A0A6P6PBQ8 | 93-174 | None |
| A0A6P8RIF6 | 74-167 | None |
| A0A2Y9DNN7 | 188-263 | None |
| A0A5E4B6T1 | 19-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.