DPCstruct | MC60257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 132 ± 27 aa |
| Standard deviation of domain lengths | 26.81 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.37 |
| Pfam Score | 97.87 |
| Assigned Pfam label(s) | PF01775- CL0110- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4P193 | 1-100 | MVKNYGIWLRYNSRSGTHNMYKEYRDMTEEGAVTQMYREMGARHRARAESIQIIDVKQIPASKCKRPYITQFHDSKLKFPLPHRVNR… |
| A0A484KN96 | 395-535 | YHHYQVVGRALPSESEENPKMYRMKLWATDEIFEKNPTVIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVDQMYTEMASRHRVRRH… |
| A0A5D2JYW6 | 33-170 | None |
| A0A803QES2 | 151-304 | None |
| K2SN38 | 13-127 | None |
| A0A2K6TWD8 | 17-137 | None |
| A0A835JQ25 | 29-178 | None |
| A0A5P1EY33 | 29-178 | None |
| A0A835GZ07 | 29-172 | None |
| A0A218X330 | 5-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.