DPCstruct | MC60254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 15.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484KE11 | 1-193 | MEIDKCSANDAAQADAPNILLNLELPTNDLWFKKKKKLLEDIGFNPSGPVCLQSFATADQLKTALTVILQRARIINLDELELYFGGD… |
| A0A453GIL5 | 2-149 | DLLVVRLPSPSAEDPLHHDKKKLLEARKLSCTFQVPISSSPVDACKLLDQMIHAARVAHMDELELYFAGGDDYGPFSARNELESLNL… |
| A0A6A1UWN5 | 1-171 | None |
| A0A6A6MBU1 | 2-139 | None |
| A0A7N0VMT5 | 28-199 | None |
| A0A2K3LCW7 | 1-155 | None |
| W9RH21 | 34-202 | None |
| A0A1D6IZ63 | 1-166 | None |
| A0A1U7X6D7 | 5-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.