DPCstruct | MC60251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484K149 | 16-122 | KKHFDESSSDVCATESQSEEESFRINYFLFIVDEAISSLTSRFEQYQQYENIFGFLFTSDKLHSLDDQSLKVCCNNLETSLKHAEHS… |
| A0A453QDS3 | 1-90 | SAEESFRVNYFLRIVDQAILSLTSRFDQYQGYQKIFGFLFTSETLQSSDKNSLKTSCDNLEVALKKDGKSDIDANELYAELMFLQNF… |
| A0A6P8VS13 | 158-303 | None |
| A0A3L6DEA9 | 30-152 | None |
| A0A4C1XNL8 | 85-210 | None |
| A0A7N0RD44 | 257-397 | None |
| A0A5S9XHV0 | 4-94 | None |
| A0A2S2R5S5 | 9-129 | None |
| A0A6A4JQW5 | 73-202 | None |
| J9LVQ1 | 19-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.