DPCstruct | MC60250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 295 ± 36 aa |
| Standard deviation of domain lengths | 36.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 14.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522WUI7 | 20-332 | LGISNPRAVRLANAAWDSWEKQGVSRGKDTDDVIHQPHLIFKKYYLDIVKANNLKNKNVHFCLARTKELNAYANTTKNGDYVVVFDS… |
| A0A7S6MQ44 | 16-281 | FSEIVANALGIPFDKNQTKENAYKLYDLYYKDISLVLPEETHNCRFDNFASGSFVAFADQEKNIPLINIDQQWSMFFLDANILTCIR… |
| A0A3E1PA31 | 36-307 | None |
| A0A497YAB7 | 1-336 | None |
| D2QEP8 | 2-257 | None |
| A0A2A8NI58 | 2-220 | None |
| A0A7W5KPM1 | 57-298 | None |
| A0A7C8DCB7 | 2-228 | None |
| A0A420G9Q9 | 19-286 | None |
| A0A3E0NQZ6 | 49-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.