DPCstruct | MC6025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 17.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3G0J6 | 1-70 | SCRGRCGGEYYRGYTCQCDYNCLAYEECCRDYESQCTTNSCKGRCGETFKRGRLCSCDPECTKFKQCCPD |
| A0A4W4GFJ2 | 27-144 | EGLFLALHDFSPPPVPVSCQNRCYEPYDYETPGCRCNEQCISNNNCCYDFQEICLQPAESWECTLLRCGEKRVAGSKCQCSEDCLHA… |
| A0A3P8PML3 | 25-133 | None |
| A0A2K6EUM9 | 14-108 | None |
| A0A3Q3X7I9 | 26-149 | None |
| A0A6F9CXJ1 | 3-73 | None |
| A0A3B4AIM0 | 44-147 | None |
| A0A498NCZ2 | 367-444 | None |
| A0A7M7HLE8 | 62-149 | None |
| A0A3C1KTR1 | 135-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.