DPCstruct | MC60249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 332 ± 49 aa |
| Standard deviation of domain lengths | 49.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521X5L4 | 5-354 | IPKLFDELKTLSSRDSFELFFDVCGNHITISDCSPDSFRKIQEHILDNNDEVEYEIELNIRKNQIESTLSLYFLDKFSEYLEAESLL… |
| A0A6L9HX95 | 1-281 | MPLDEVMKAFALLLRETEKHIIFEMFDVEDTFNTKTMFFLPAGRAIVLSGFDRRQRLQECRETSYFYNQETYELLPDDFRIENGYEG… |
| A0A0C2JZJ7 | 367-697 | None |
| U9TTA0 | 1-415 | None |
| A0A1E3L7V1 | 1-277 | None |
| F9RQS0 | 2-308 | None |
| A0A2E1AG61 | 133-449 | None |
| A0A1C5XDQ4 | 2-253 | None |
| M0M9E4 | 85-423 | None |
| A0A849Y776 | 1-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.