DPCstruct | MC60244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10050 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7XJN1 | 2-91 | EIKLIDRATIRVEDWVRMKCQFGCGGYGARLTCPPYSPTPDQTRRIIKDYKNALLIHSRNSRKIKEAVPEIERELFLKGFYKAWGMG… |
| A0A0E3PRU7 | 4-117 | EDENYRLLEDKAKELGAKSLRLLPAENIVVEDRTVLKCIFGCNGYGSRVCPPFIPTVEEFKKILADYEWALLVEWNSNNVFSREVSE… |
| A0A0W8F6V3 | 9-118 | None |
| A0A5K7ZCC8 | 60-167 | None |
| A0A2V2G464 | 49-149 | None |
| A0A099SJ24 | 2-99 | None |
| A0A847PM22 | 3-95 | None |
| A0A2M7CD08 | 1-76 | None |
| A0A1M5XM61 | 257-352 | None |
| E1YCV8 | 149-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.