DPCstruct | MC6024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 49.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495V3L6 | 6-90 | RAEYWSANLRLLAILLTIWFIVSFGFGILLVEPLNTIMLGGYPLGFWFAQQGSIYIFVALIFIYAVSMNKLDNKFDVGEDSGSGT |
| A0A424NAW7 | 2-78 | KNLSYWKLNLIVISGLLSVWFIVSLGFGVLFSESIDHIRLGGFKLGFWFGQQGSLLFFLLIIFVYCIIMNKLDERFK |
| A0A2D6PXI9 | 2-89 | None |
| A0A2E0QM83 | 3-80 | None |
| A0A2D6RDE2 | 60-137 | None |
| A0A352Q4G0 | 40-126 | None |
| A0A3B0SYI1 | 20-91 | None |
| A0A7K3MC56 | 89-173 | None |
| A0A081N343 | 8-86 | None |
| A0A2E3UAD5 | 6-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.