DPCstruct | MC60234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 280 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.41 |
| Pfam Score | 99.07 |
| Assigned Pfam label(s) | PF07983- CL0036- CL0046- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6TAD6 | 12-100 | PRTWCALNPNARDLGKLGANIDYACTFADCTPLGCGSTCNGMDTAGNASYAFNAYYQVQNQKDEACDFQGLALPTEKDPSTATCNFT… |
| A0A7J7NAA1 | 9-98 | GYLWCVAKNNAEDTALQNTTDWACRGGGADCKPIQEGGPYYDRNNIQASTSYAFNDYFIKHKIGPEGSCDFGNITNVYSRNTSYGNC… |
| A0A7S2SDA9 | 203-287 | None |
| A0A6D2JGZ3 | 120-202 | None |
| A0A6S7N9K0 | 70-164 | None |
| A0A3B6MVR8 | 333-431 | None |
| A0A1Z5S4U2 | 108-201 | None |
| A0A835JQH4 | 1052-1153 | None |
| A0A835JNA4 | 257-362 | None |
| U5D6W9 | 113-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.