DPCstruct | MC60233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 71 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.83 |
| Pfam Score | 93.61 |
| Assigned Pfam label(s) | CL0361- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7N8K5 | 1-68 | MVWFQCEDCGENLKKPKLENHFRNCSSYKLSCIDCGETFGQQSVQGHTQCITEAEKYEPKGQAKAPGS |
| A0A7M7R9K3 | 1-65 | MVFFTCNACGQAIKKAQVEKHYQQRCRSCEVLSCMDCGKDFYGDEYKLHTQCISEDQKYGGKGYQ |
| A0A366RRG3 | 79-148 | None |
| A0A4S2MS32 | 1-77 | None |
| A0A022QL72 | 182-259 | None |
| F4Q7L8 | 1-86 | None |
| A0A1X6PHZ8 | 1-77 | None |
| A0A820HRG7 | 1-55 | None |
| A0A286XL75 | 1-49 | None |
| A0A1Y1W6H9 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.