DPCstruct | MC60230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 19.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7N2A5 | 1-178 | MAETKQDLLCASLAVLVDVANDAKRADQEIMYSKVLSSVLTSMEVWSETRLLDYHERFHKGAVGLMENLLPFALSVAKILDEDISNL… |
| A0A6A6K969 | 347-496 | QYSKVLSSTLSCILGWSEKRLLAYHETFDSGNIEAMQSIVSLGVSAAKILVEDISNEYRRKRKGEVDVAQSTIDTYIRSSLCSVFAQ… |
| A0A7J7MXI1 | 1-131 | None |
| A0A7J7MQV4 | 1-131 | None |
| A0A835PKB5 | 176-310 | None |
| K4C0A5 | 128-284 | None |
| A0A4Y7L413 | 389-537 | None |
| A0A1D6KTQ3 | 191-372 | None |
| A0A0D2TDU3 | 122-251 | None |
| A0A0R0FRF3 | 468-619 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.