DPCstruct | MC6023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419SED0 | 20-71 | VRCPNCQRVNVGQVAPKYFYCSDCFIEMKLGKTIEFFELDENGELACLNDIF |
| A0A2N5GVV8 | 1-54 | MLTCPNCSSKDIGKIGINQYYCWNCFIELSLSQGIIHTHQVEEDGTLSSLDDLF |
| A6TT72 | 4-62 | None |
| A0A1M5Q878 | 5-66 | None |
| A0A7C6LNI8 | 2-51 | None |
| A0A3A6NMF9 | 1-53 | None |
| A0A4R2RMZ2 | 1-50 | None |
| A0A7C6ZFE6 | 35-84 | None |
| A0A7C6Y478 | 1-52 | None |
| A0A6F9DYW2 | 27-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.