DPCstruct | MC60224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 148 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7MQA1 | 7-166 | FHKSIFLCFFDSCKVISKREDVYRVVKAFASRGEWMNPDAKRFIQHLVWEQTSFLYTDLSVRDFERNGLNLTLSKREEVQRLRTQID… |
| A0A0F4Z6D9 | 74-220 | AFYQAVSTDQKLRDASSEAEKLLDDFAIETSMREDLYRLVDAVLKKNEDLDPESRRLLEKEHKDYIRNGLGLPAGPQRDRFKEIKKR… |
| A0A2B4RWE7 | 17-198 | None |
| G0T0T2 | 144-286 | None |
| A0A183MXQ1 | 26-160 | None |
| A0A7R8WZ97 | 597-735 | None |
| A0A6I9Y8C9 | 1-169 | None |
| A0A084RNU1 | 280-432 | None |
| A0A835HM18 | 111-251 | None |
| D3BBB4 | 159-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.