DPCstruct | MC6022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 201 ± 37 aa |
| Standard deviation of domain lengths | 37.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5GVJ6 | 26-193 | VGAGLGLTAKKAMDFESQMSSVKSVMSPDEVNEFGASLTDLAKKMGAETKFSSLEAAQGIEELIKAGVTVTDIINGGLDGALSLAVA… |
| A0A147FKC1 | 209-408 | GSMDYAQRYQVVATDVTEQDQARILTPQAKRIGQETKFSNEDVVHAQTGTMQGLPFKDPKMKAEVGASIVDQARHYAVIMQSDMTRS… |
| A0A0D0SEC9 | 41-225 | None |
| A0A0F2N598 | 206-451 | None |
| A0A1V5BSE9 | 4-223 | None |
| A0A3A5F9J9 | 12-209 | None |
| A0A842MQP2 | 252-485 | None |
| A0A076LFK6 | 21-226 | None |
| A0A0K2RS29 | 5-244 | None |
| A0A807ZK77 | 9-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.