DPCstruct | MC60217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 134 ± 28 aa |
| Standard deviation of domain lengths | 27.79 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9ZV50 | 8-119 | VYWLGDAECHQLSERSYYLNDNQMPFCARDLGLFAGIAAGFGFAAFYRSKVKPWIFLIAVLPLGIDGGAQALTSYESNNPLRLGTGI… |
| A0A521UQK5 | 34-179 | LFAVNGVMASITALSMAAPWLMAIGQSWAADAVYRLYASICHQLPFRSYFLFGYQMAYCQRNFAIFLSLLLAGLVFAALRRRMRPID… |
| K2BSI0 | 12-120 | None |
| A0A662MEL9 | 20-123 | None |
| A0A662MCU0 | 68-225 | None |
| A0A832X5Z3 | 5-117 | None |
| A0A3M0SV96 | 13-114 | None |
| A0A7V3M9J0 | 5-199 | None |
| A0A6V8D9E7 | 213-381 | None |
| A0A497NG76 | 3-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.