DPCstruct | MC60216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D4PMP8 | 1-101 | MTKNIRKAIANPFPSRRVEALVEVLIAGKWGATGWLYNPNVAGFGSGISAYPYGSGSSDDFIIIQSGGLEVTTSSSSAGNPHGINAQ… |
| A0A7T0GYU2 | 120-228 | YALVDFGTVGVNARYVQANPFGNSTPVICQVEIYFNGKWGAPGWVGWYENSIMNTYGLRGGMVLGEGLVVQTARSYLEAPSNNVGSL… |
| A0A7X6WMM7 | 840-951 | None |
| A0A6G9IDJ3 | 162-277 | None |
| A0A2U1TTC2 | 241-351 | None |
| A0A0H3I6V4 | 193-293 | None |
| A0A093S4H0 | 1-113 | None |
| A0A7V8TN40 | 92-204 | None |
| A0A433SHP0 | 264-373 | None |
| A0A2M9GQ62 | 108-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.