DPCstruct | MC60213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 407 ± 62 aa |
| Standard deviation of domain lengths | 61.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397D1M1 | 605-1021 | ITTHAMTKCLFFDLYDTLVTATVSSVVVFAYMQVLPASTPDPSYYLLLVSLVLSLGFPFFIQYGISSSYEKQLGFGVAVLGTIVALF… |
| A0A7M5XJX9 | 10-385 | VNEMALVSQYKYTDYKWLVDFSVCAVIVYLLIEMAASLRPQIFVDEFNVGIVWCMLVVYFALRELFSLTAAYWRSEDGGERAMAISF… |
| A0A3P7NZ84 | 19-528 | None |
| M4BJH2 | 25-436 | None |
| A0A6P4LPZ2 | 1-361 | None |
| A0A286YCA7 | 3-304 | None |
| A0A2K5XX05 | 10-323 | None |
| A0A8B6H2Q1 | 533-1004 | None |
| A0A226N296 | 46-487 | None |
| A0A3Q2TWL9 | 19-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.