DPCstruct | MC60207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 222 ± 24 aa |
| Standard deviation of domain lengths | 23.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2M0X2 | 5-220 | DGLPVPPDKAYLREELSRIDESWAAARFDSLPHVVHILTSKDREAEARVLKEQSDVVEDVVDEVVQSYHSGFNKAIQNYSQILRLFS… |
| A0A397C873 | 3-198 | ASEEIDRVFLDKKFSATKYMLRYIVGASEDVRKDQLQTIGRYRSLADQEIAGVVESNYSNFNASLGKFNVISNQLQEARAGLVEVSK… |
| F0W5T7 | 4-195 | None |
| F4RJE0 | 284-572 | None |
| A0A4S4ESS3 | 97-316 | None |
| L0PGU7 | 39-263 | None |
| A0A811U323 | 1-232 | None |
| A0A0G2EDD0 | 92-330 | None |
| A0A446YG54 | 7-220 | None |
| H2XRU0 | 4-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.