DPCstruct | MC60206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Standard deviation of domain lengths | 14.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3TLF4 | 1-76 | MDQVMVHDLMSLHYEAHAARFSKAKNNAALKEAWLLLSTELSTNQGMSISSEQCKNKLKWLKRKWAEYNADIRATG |
| A0A397C429 | 1-91 | MKPKRFRKQVPRTYLWCDDSVEKMFMLRYKSALAPRFESKNNYGKRVAYVMLATELSVSMEREFTAKQVQDKVRHFMFKVYQLINAL… |
| A0A397ENH8 | 341-420 | None |
| A0A6A4DCL1 | 74-157 | None |
| A0A3R6WF71 | 1-84 | None |
| A0A397EWM3 | 47-136 | None |
| D0P044 | 76-182 | None |
| A0A6G0XPE3 | 81-157 | None |
| W4GLY7 | 29-130 | None |
| A0A6A3NTG0 | 88-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.