DPCstruct | MC60203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5RZV3 | 93-153 | MKKKDVQVGNTYAAKIGSQVVPVRLDAESRFGGWDATNLRTKRRVRIKSAAKLRHPWRTST |
| A0A5C5W5K7 | 1-75 | MKKKDVEIGGIYTAKVSNTLTTVRIERTNYYGGWDATNLATGRRIHIHSAQRLRGPVTPKREATIDQVVTSLHTE |
| A0A7C4HSY8 | 1-63 | None |
| A0A357XYE7 | 1-74 | None |
| A0A7C4X2Q1 | 1-64 | None |
| A0A7S6MF36 | 1-77 | None |
| X0U502 | 1-64 | None |
| A0A3A0DYR0 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.