DPCstruct | MC6020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 225 ± 46 aa |
| Standard deviation of domain lengths | 45.67 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.75 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF15575- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H6MY55 | 19-256 | LIDLCVWSLVGSGGVVGEEVWSALDAACEVCRVQFVRASLPKGEHRLSFEVLGRSLETGSSGPNPYTMAPDWLAALWLGLVARDRGL… |
| A0A1Q4YD87 | 43-284 | LNSLLSNALRHLGHRCAVDPRGSNGDTWDSLLFATRVGSAVFAVATAEPGTTVTLDLGERSVEATATGPEYFTSATNWLTATWLAYA… |
| A0A222FIF2 | 13-216 | None |
| A0A3F2UU73 | 129-338 | None |
| A0A1M5HUX6 | 443-691 | None |
| A0A1K2FCC5 | 236-475 | None |
| A0A7K2XX71 | 73-263 | None |
| A0A165KJG3 | 47-291 | None |
| A0A7W7LZF7 | 6-184 | None |
| A0A7W2TMX2 | 2-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.