DPCstruct | MC602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Standard deviation of domain lengths | 11.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11195 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645J6X5 | 24-148 | YWCWENDTIMMYCKDGKVLDIRETTTVDYTFSNVTSDEWILADAENTPVLGGEALFGFDEAMKYLKRGIPVRRKAWQPDVKICTQFP… |
| A0A3C0QSH3 | 303-392 | TITKDSKPKRDTTYSFSDALTALKENHKVTRSVWESSGILLQIALPDPAQQDDSALDNQPIIQMRTADYKIVPWEATTEDLLASDWV… |
| A0A0H2Q7J4 | 1-87 | None |
| R9VM91 | 4-108 | None |
| A0A0G1FD79 | 1-84 | None |
| A0A077MZV6 | 7-102 | None |
| A0A2N5LGN4 | 1-72 | None |
| A0A3R7T4U8 | 1-71 | None |
| A0A7K0GQ12 | 33-126 | None |
| A0A4Y9ESJ9 | 5-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.