DPCstruct | MC60196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7IZJ4 | 2-116 | MQPTKSYWISNDNTPAMAKNPRQEINLHSPDDPTKFPALSKIDSLPDTFMRFIPTDRVKDVAQLTVPFFDSQTVAPTPSSWLSGIEL… |
| A0A1B6KBP6 | 497-632 | KIGAHLNLEIRATPINFTSGELIDPGRKDQWLSNDNTDGTLIKPRTKLKLDSPDIPLNALSPSKIDSVNDQYLQFTHSDIDLDAAQT… |
| A0A4C1TDY9 | 124-244 | None |
| A0A6H5I7N8 | 351-447 | None |
| A0A834XMP7 | 666-764 | None |
| A0A6P8XXE0 | 272-366 | None |
| V5GA77 | 169-272 | None |
| A0A0C9QGU1 | 570-685 | None |
| B4Q7J5 | 353-477 | None |
| A0A6J1R274 | 39-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.