DPCstruct | MC60190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 250 ± 50 aa |
| Standard deviation of domain lengths | 50.25 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7IEJ3 | 18-272 | GCSCDATCRQYGDCCRDSQYYDAAEQTKNVNEYECVDDPLYDGVNVYMRAKCLEKWNNTEVQALCLMGNTQTGDSKLFPVISTTTAT… |
| A7T362 | 208-411 | ECRCDPYCTSFKDCCADFDTFCPEVARGRPLLPLQLYECVSNFRVYDIWMITVCPWNWTEESVSQKCMSNEKMTSQNYDNVIPVTTA… |
| V4CAQ9 | 47-261 | None |
| A0A443RFX2 | 411-681 | None |
| A0A1S3JEF7 | 160-363 | None |
| K1Q5I7 | 52-259 | None |
| A0A7D9MLH3 | 2-197 | None |
| A0A4Y2LB40 | 34-311 | None |
| A0A2P8YS80 | 74-308 | None |
| A0A2G8LRG7 | 80-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.