DPCstruct | MC60186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8JFM1 | 87-153 | EVLCHVSIGGSMFRRRFEANTNLTYTFQWDRMDMFGRPYTGLVEARVSVGYKYANCPDIVWDFTSAL |
| A0A2R8QBU6 | 766-849 | TQAVVPLSLVKVHLMVAVEGHLFQKWFHASPNLAYTFIWDKTDAYGQHVYGLSDAVVSVGYEYESCPSLVLWEKRTAMLQGYEL |
| A0A817YU79 | 962-1065 | None |
| H3B181 | 413-497 | None |
| A0A1I8IQV0 | 593-693 | None |
| A0A1A8VL89 | 865-946 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.