DPCstruct | MC60184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 117 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0TQ73 | 3-147 | MNNIPRQTLYQLIQKEGITRCREAKKCKAILSDLCGEYPKEISALVVALEEQVIDELQKNARVIPLELLLKQLAERIQNKRAITEEA… |
| A0A177QT17 | 1-107 | MSQLPIRMLQQLLANHGRVLGENAELCRQLMLAECPLYPRHVEAIVAAVELGVVNELNMAGPEQRYHEVTRPLVERMTAGGAMSDSE… |
| A0A4R7BYA0 | 1-122 | None |
| A0A7C3B9Z8 | 1-100 | None |
| A0A3C0I6W8 | 1-114 | None |
| T2JLG0 | 1-129 | None |
| A0A4Q3W288 | 3-116 | None |
| A0A538B1J4 | 1-112 | None |
| A0A239GK16 | 1-117 | None |
| A0A7Y0PDQ3 | 115-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.