DPCstruct | MC60183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 116 ± 21 aa |
| Standard deviation of domain lengths | 20.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.98 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0268- PF00572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I3H9H0 | 3-101 | FRGPYHFRAPSRIFWRTTKRGQAALDRLKVFDSIPQPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGEEERESQDLLPEEET… |
| A0A7E6DEP1 | 6-87 | TKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQ |
| A0A2H4SW77 | 465-585 | None |
| A0A6V7NLG6 | 87-177 | None |
| A0A0E0P1H6 | 542-677 | None |
| A0A7N0U6W6 | 38-146 | None |
| A0A7R9KME6 | 134-272 | None |
| A0A453REM1 | 5-67 | None |
| A0A3Q0IU91 | 1-90 | None |
| V5BAB2 | 148-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.