DPCstruct | MC60182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.81 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF14648- PF14647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I3H0G0 | 4-114 | DVEFHIQHNYSWNKLPANMRHRLGNSQRDYEKQVVLYSICNQNNLVKHVKKDECRHYEELLKYSRDHLMLYPYHLSDIMEKGLRITP… |
| A0A834ZZI4 | 11-124 | QLLLKSIKEECPWENLPKRLQSTLSSKEEWHRRVIDHCIKKRLQWNSCFARKVCKEGEYYEEMMRYLRKNLALFPYHLAEYVCRVMR… |
| G0NCG8 | 1-116 | None |
| A0A1Y3BTS7 | 1-89 | None |
| A0A5J4W7B8 | 5-110 | None |
| A0A7J0EHB6 | 3-122 | None |
| A0A4V3WQC9 | 104-230 | None |
| A0A3Q0IMV8 | 1-122 | None |
| A0A0S4JKR7 | 4-143 | None |
| A0A5A9NQJ8 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.