DPCstruct | MC6018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M6WWY0 | 53-136 | EGIAMQFTKSKGYLTVQATEEGYFYIFFDSNLHEIHSNDYDDPKVSVQKATYEILKSERMDDMECVKVDYKEFETMTIQHSKDL |
| A0A839JWE1 | 3-99 | QEEMRETELAFRIADRIISIQECDDGYDYSIMDENYREIDGGVYDNPEISIREALKDIIEDLKQNPDTNGAKGNISMESELVLLDFD… |
| A0A7X3MCU4 | 466-544 | None |
| A0A7X3SM30 | 11-101 | None |
| A0A0D0SLL3 | 11-96 | None |
| A0A416NX08 | 172-251 | None |
| A0A416PDF4 | 81-163 | None |
| C6J8H3 | 84-183 | None |
| A0A413PZM9 | 215-295 | None |
| A0A415SAW5 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.