DPCstruct | MC60177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 3.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0498 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810QKY8 | 95-155 | IYPQILDDTIPEQRELGLTLGYHLLAACSEMWVCGERISDGMAKEIHHAERLGINIRYIRK |
| A0A1C6F334 | 46-105 | YLPFLLDDTAPEERALALEFGQKLLAMCTRLVVYGDRISSGMSAEIMKAEELGIPVLQRP |
| A0A542AQH1 | 39-102 | None |
| A0A519T1T3 | 22-87 | None |
| A0A3E5AR49 | 139-207 | None |
| A0A3A9H059 | 33-90 | None |
| A0A174W102 | 48-107 | None |
| A0A4R4D1R4 | 41-102 | None |
| A0A6I6DEU6 | 46-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.