DPCstruct | MC6017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 225 ± 30 aa |
| Standard deviation of domain lengths | 30.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.82 |
| Pfam Score | 52.50 |
| Assigned Pfam label(s) | PF14191- PF18830- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3SM30 | 1-237 | MTNEQENQDVQELAFQLADRYIRIQETGEGYDYTIYDMNYRELDGGVYDNPDITITEVLYEIELGLKEPMHRSELEGNIHSYDKLIP… |
| A0A3E5ALJ8 | 312-538 | VEPDELEYSIDDGNMFVGIHRCDDGYDFSVYDSDYSVIDGGVYDNPDISIYSAFKNVSDDYLPETRELKLIDYDDFTEKVDLVEQAH… |
| R7F9C2 | 61-258 | None |
| R9IYQ9 | 359-576 | None |
| A0A3A8YAP1 | 649-805 | None |
| A0A7U9MV89 | 26-255 | None |
| A0A0V8QC47 | 731-965 | None |
| A0A4R2L7S2 | 333-589 | None |
| A0A3D2EH07 | 1-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.