DPCstruct | MC60168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 82 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645I7X2 | 12-87 | IIYIPRSDGNSIVPGNEYELVYWDHDNWASLGIKIADDDFLEYSNCPKGALFLLHNHTEGVEERIFTYKNGEQIWW |
| B3CA38 | 249-333 | DLGAPASISRIHYLPLTDDNNIVPGETYELLVGDDKGFNSLGMKVAEYSYIDFDSVPVNGLYWIRNHTKGREERIFTFERNRVIF |
| E5UXS7 | 330-392 | None |
| A0A1V3N3S6 | 5-82 | None |
| A0A348PD78 | 1-69 | None |
| A0A7T9U022 | 553-640 | None |
| R9I902 | 46-107 | None |
| R7DQS6 | 70-156 | None |
| A0A6L4Z821 | 122-206 | None |
| A0A1Q6IJC9 | 147-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.