DPCstruct | MC60165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 202 ± 42 aa |
| Standard deviation of domain lengths | 41.86 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 29.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A261Y756 | 43-224 | SPSPNAGRTAQITSDTDFCMFLPPQPGEIVANDEWDALGFCTKANNNASGARLLPNNFITSAHFARGDNYVQVTGLFDVNAYQMNAS… |
| A0A0L6WKE0 | 63-310 | MPYKADTDVGDRGGQLGYNRCNSSTEGHSSLCQTSFLNSVDDFCLWGPPNPNSVVGDVEGEMVAWCTKAGRGTRVIPSGAITGVQFT… |
| A0A2X0NZC6 | 4-188 | None |
| A0A433QCJ3 | 6-157 | None |
| A0A0C3C513 | 23-211 | None |
| A0A0C9TPU7 | 60-275 | None |
| A0A0S2LIR4 | 53-272 | None |
| G4T7X5 | 158-370 | None |
| A0A507FMU2 | 228-448 | None |
| A0A1J8PH50 | 67-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.