DPCstruct | MC6016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 239 ± 45 aa |
| Standard deviation of domain lengths | 45.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348HI41 | 157-416 | RTALELSRQYYDTRSQCNDGSPAYMCTGVMLRSNKNYSDQYHVWDPSPFSTKTGGTSFSWLRSDTRYSHLAFGYNSGFIFFPQQKAD… |
| A0A423DS03 | 19-283 | EDSRQDCDGEPAYACSGIMLRVTSPSSQYYTWNNSPKAVAKRGVSFSYLRADAPISALAESARSGYTLAPIKLRPAGSMSYKPLCAY… |
| A0A7S4IB00 | 1-133 | None |
| A0A7S4HJA6 | 7-252 | None |
| A0A291E654 | 38-304 | None |
| A0A291E5Q2 | 404-661 | None |
| A0A1H5I1M9 | 124-371 | None |
| A0A7S4N1G0 | 12-228 | None |
| A0A3S4IZT2 | 8-214 | None |
| A0A809SHM3 | 64-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.