DPCstruct | MC60156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 197 ± 33 aa |
| Standard deviation of domain lengths | 33.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6DR33 | 28-219 | FPWLAIAATTLFLSPSWPRRILRLHLPAVERNEPVSQRKQTLVLSLAAIYVAFQILVPLRNFIHRGGIEWSCMEHRFSWQMMLHRHT… |
| A0A1Y6CHV3 | 4-167 | ARPSADDWPAPSRARKRLVLGLIAAWLALQVLVPARHWLYPGNPSWTEEGHRFAWMMKLRDKLATADFTVRDPATGRTWQVDSSQFL… |
| A0A7Y2VBX9 | 66-271 | None |
| A0A1P8WFL4 | 110-338 | None |
| A0A7R9A5D8 | 34-209 | None |
| A0A1G1JY54 | 85-282 | None |
| A0A1F3S659 | 57-240 | None |
| A0A2E5G114 | 245-461 | None |
| A0A1G1JWP4 | 2-174 | None |
| A0A443R216 | 16-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.